DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and litaf

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_988970.1 Gene:litaf / 394567 XenbaseID:XB-GENE-1017030 Length:148 Species:Xenopus tropicalis


Alignment Length:140 Identity:54/140 - (38%)
Similarity:64/140 - (45%) Gaps:20/140 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PPQFTYVPPPSAPPSYQEAVGGVKPVGP----------------YTPV-VAPATTANTTIVTTVV 55
            |..||.   |||||||:||.....|..|                ..|| :.|..|..|..|...:
 Frog    11 PIGFTV---PSAPPSYEEATFHHPPYPPLHQGMDAKNMSNPPYIVQPVPMQPPVTVQTVYVQQAM 72

  Fly    56 PISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPN 120
            .:......|.|.||::.|.|......|.:|:||...:.|.||..||||||.|||...||.|.|||
 Frog    73 TLYDRPVQMCCRSCNSMITTRLEYSSGALAWLSCGGLCLLGCIGGCCLIPFCIDSLKDVDHYCPN 137

  Fly   121 CRAYLGRYRR 130
            |.|.||.|:|
 Frog   138 CHALLGSYKR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 32/68 (47%)
litafNP_988970.1 PPxY motif. /evidence=ECO:0000250|UniProtKB:Q99732 20..23 2/2 (100%)
zf-LITAF-like 78..146 CDD:371158 32/67 (48%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 101..123 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8365
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm48436
Panther 1 1.100 - - LDO PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.