DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and CG13516

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster


Alignment Length:129 Identity:42/129 - (32%)
Similarity:58/129 - (44%) Gaps:20/129 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PPSAPPSYQEAVGGVKPVGP--YTPVVAPATTANTTIV-------TTVVP-----ISRTSTHMIC 66
            |..|||||..||.  .||.|  ..|.:|||......:|       .||||     :....:.::|
  Fly    37 PIEAPPSYDVAVS--VPVAPAVSAPAIAPARPPPVVVVEQPAPQPPTVVPTDTLHLGPNRSRVLC 99

  Fly    67 PSCHAEIETT--TRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRY 128
            |:|.|. :||  |.|.......::| |:.|.|.....|.:|.|::.|...:|.|..|..:||.|
  Fly   100 PACGAN-KTTRMTHTANSRTHMVAG-LLCLVGFCCCACFVPYCMNSCRTGNHYCRKCNTFLGAY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 22/71 (31%)
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D155863at50557
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.