DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and CG13559

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster


Alignment Length:111 Identity:44/111 - (39%)
Similarity:60/111 - (54%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PPSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTIVTTVVPISRTSTHMICPSCHAEIETTTRTE 80
            |.:.||||:||:|               .....:..||.:....||:.||||.||.||||||:..
  Fly     8 PSTPPPSYEEAMG---------------WETRRSHSTTWLLAENTSSLMICPMCHDEIETTTKIR 57

  Fly    81 PGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLG 126
            ...|||::..::....|.:||.||||.:|...::|||||.|:|.||
  Fly    58 RRWIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKATLG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 34/67 (51%)
CG13559NP_611801.1 LITAF 38..107 CDD:197841 33/66 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 0.820 Domainoid score I9359
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D155863at50557
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - mtm6622
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.