DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and CG13511

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001246466.1 Gene:CG13511 / 37597 FlyBaseID:FBgn0034759 Length:122 Species:Drosophila melanogaster


Alignment Length:115 Identity:33/115 - (28%)
Similarity:48/115 - (41%) Gaps:16/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GVKPVGPYTPVVAPATTANTTIVTTVVPISRTS-----THMI----------CPSCHAEIETTTR 78
            |..|....|.:|...|..|..:|.|.:|:...:     .|.:          ||||..|:.|:..
  Fly     7 GRAPEPADTEMVTVTTQPNYGVVVTQIPVYTLNGVGPGAHPLAVGCKPMRVRCPSCRGEVTTSLA 71

  Fly    79 TEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRY 128
            |.|....::....:.:..||...|| |..|:.|..|.|.||||..::|.|
  Fly    72 TSPTRKTHMCALTLYICCCWPFICL-PYFINYCKSVQHYCPNCGCHIGSY 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 24/84 (29%)
CG13511NP_001246466.1 zf-LITAF-like 53..120 CDD:287559 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D155863at50557
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
65.920

Return to query results.
Submit another query.