DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and CG30195

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_611696.2 Gene:CG30195 / 37592 FlyBaseID:FBgn0050195 Length:153 Species:Drosophila melanogaster


Alignment Length:94 Identity:23/94 - (24%)
Similarity:36/94 - (38%) Gaps:21/94 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TTANTTIVTTVVP-------ISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFL--IALFGCWL 99
            |.....||..:|.       :....|.:.||||  |...|:..:..::..|..||  ..|...|.
  Fly     2 TVDEPQIVAIIVSHKPQVGYLKEEPTWIRCPSC--EKSGTSLVQLELVTCLQRFLGFTKLCKKWS 64

  Fly   100 GCCLIPCCIDDCMDVHHSCPNCRAYLGRY 128
            |          ..|::|.|.:|..::||:
  Fly    65 G----------RQDINHYCSHCGCFIGRF 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 19/71 (27%)
CG30195NP_611696.2 zf-LITAF-like 26..85 CDD:295454 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.