DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and Cdip1

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001008361.1 Gene:Cdip1 / 360480 RGDID:1310686 Length:208 Species:Rattus norvegicus


Alignment Length:146 Identity:52/146 - (35%)
Similarity:68/146 - (46%) Gaps:20/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPGSAPPQF----TYVPPPSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTIVTTVVPISRTST- 62
            :||..||..    ||:|....||.......|..|.|||.|...|....:|  .|.:||....:| 
  Rat    63 QPGFVPPHMNADGTYMPAGFYPPPGPHPPMGYYPPGPYPPGSYPGPGGHT--ATVLVPSGAATTV 125

  Fly    63 -------------HMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDV 114
                         ..:||.|...|.|....|.|::.::.||.....||.||||||||.|:|..||
  Rat   126 TVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDV 190

  Fly   115 HHSCPNCRAYLGRYRR 130
            .|:||:|:||:..|:|
  Rat   191 THTCPSCKAYICTYKR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 30/82 (37%)
Cdip1NP_001008361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 3/6 (50%)
zf-LITAF-like 137..205 CDD:402300 29/67 (43%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 164..184 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8854
eggNOG 1 0.900 - - E1_2CY6X
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4960
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9086
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X238
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.