DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and Y87G2A.18

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001021834.1 Gene:Y87G2A.18 / 3564964 WormBaseID:WBGene00013604 Length:118 Species:Caenorhabditis elegans


Alignment Length:85 Identity:28/85 - (32%)
Similarity:43/85 - (50%) Gaps:13/85 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SRTSTH------MICPSCHAEIETTTRTEPGMIAYLSGFLIALFGC------WLGCCLIPCCIDD 110
            ||||.:      |.||.|...|.:......|::.::...::|..|.      |..|| :|..:|.
 Worm    34 SRTSPYNVMPIEMDCPHCQNHIVSHIERVAGVLPWIIFAILAFLGIFLFIIPWCFCC-VPFFLDQ 97

  Fly   111 CMDVHHSCPNCRAYLGRYRR 130
            .:||:||||.|:.:|||:.|
 Worm    98 LLDVNHSCPACKKFLGRFNR 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 25/80 (31%)
Y87G2A.18NP_001021834.1 LITAF 43..117 CDD:197841 23/74 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.