DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and CG12645

DIOPT Version :10

Sequence 1:NP_728818.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001096935.1 Gene:CG12645 / 31947 FlyBaseID:FBgn0030181 Length:206 Species:Drosophila melanogaster


Alignment Length:66 Identity:19/66 - (28%)
Similarity:28/66 - (42%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 MICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGC-CLIPCCIDDCMDVHHSCPNCRAYLGR 127
            ::||:|.....|..:..|.....|....:..|| |..| ||.|...:.|...:|.|..|..:||.
  Fly   129 IVCPACGQRGVTRLKRSPNARTNLWALCLCTFG-WCCCACLFPYLWNGCRTTNHYCSACEIFLGA 192

  Fly   128 Y 128
            :
  Fly   193 H 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_728818.1 zf-LITAF-like 59..129 CDD:463165 19/66 (29%)
CG12645NP_001096935.1 zf-LITAF-like 129..193 CDD:463165 19/64 (30%)

Return to query results.
Submit another query.