DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and C08E8.1

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_507591.2 Gene:C08E8.1 / 182406 WormBaseID:WBGene00007437 Length:102 Species:Caenorhabditis elegans


Alignment Length:104 Identity:32/104 - (30%)
Similarity:43/104 - (41%) Gaps:21/104 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VKPVGPYTPVVAPATTANTTIVTTVVPISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIAL 94
            :||| ...|.|...|...|:.:|            .||:|.....|:..|..|    :..:||..
 Worm    13 IKPV-KSAPYVVKETPLKTSFLT------------YCPTCEKAYMTSVNTHIG----VCWWLICF 60

  Fly    95 FGCWLGCC---LIPCCIDDCMDVHHSCPNCRAYLGRYRR 130
            ||..| ||   |...|.|...||:|:||:|...|.:..|
 Worm    61 FGTVL-CCFPFLFFLCCDVSKDVNHNCPSCGMLLAKKNR 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 23/71 (32%)
C08E8.1NP_507591.2 LITAF 31..98 CDD:197841 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.