DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and LITAFD

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:XP_011521084.1 Gene:LITAFD / 101929989 HGNCID:53927 Length:121 Species:Homo sapiens


Alignment Length:114 Identity:37/114 - (32%)
Similarity:48/114 - (42%) Gaps:21/114 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTIVTTVVPISRTSTHMICPSCHAEIETTTRTEP 81
            ||..|.:..                |...|..::|.|.:|:     ..:||.|...|.|.|...|
Human    28 PSRAPGWNH----------------PRLYAGMSVVGTSMPV-----QAVCPYCGNRIITVTTFVP 71

  Fly    82 GMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130
            |.:.:|....:.|||..||||.:..||...|||.||||.|:..|..|.|
Human    72 GALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 27/68 (40%)
LITAFDXP_011521084.1 zf-LITAF-like 51..119 CDD:371158 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.