DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and TUT1

DIOPT Version :9

Sequence 1:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_073741.3 Gene:TUT1 / 64852 HGNCID:26184 Length:874 Species:Homo sapiens


Alignment Length:751 Identity:140/751 - (18%)
Similarity:227/751 - (30%) Gaps:281/751 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 SPATTASSTAATTTGPATSMSDTSNNPPQSTTTPASRTNS---IYYNPSRKKRPENKAGGAHYYM 242
            :|.:.:..:|..:.....:::.|..:||.| ..|||..:|   .:..||....|:......    
Human   235 APESPSLDSALASPLDPQALACTPASPPDS-QPPASPQDSEALDFETPSSSLAPQTPDSAL---- 294

  Fly   243 NNHMEMIAKYKGEPWRKPDYPY----GEGVIGLHEEIEHFYQYVLPTPCEHAIRNEVVKRIEAVV 303
              ..|.:|..:..|   |..|.    .||.:|...|:..       ||.|        ::.|.. 
Human   295 --ASETLASPQSLP---PASPLLEDREEGDLGKASELAE-------TPKE--------EKAEGA- 338

  Fly   304 HSIWPQAVVEIFGSFRTGLFLPTSDIDLVVLGLWEKLPLRTLEFELVSRGIAEACTVRVLDKASV 368
                  |::|:.||...|          .|.|::.                     |:.:..|..
Human   339 ------AMLELVGSILRG----------CVPGVYR---------------------VQTVPSARR 366

  Fly   369 PIIKLTDRETQVKVDISFNMQSGVQSAELIKKFKRDYPVLEKLVLVLKQFLLLRDLNEVFTGG-- 431
            |::|...|.:.:..|:|.:.:..:.::..:.........:..||..|:.:...|.|    :|.  
Human   367 PVVKFCHRPSGLHGDVSLSNRLALHNSRFLSLCSELDGRVRPLVYTLRCWAQGRGL----SGSGP 427

  Fly   432 -ISSYSLILMCISFLQMH------------------------------PRGIYHDTANLGV---- 461
             :|:|:|.|:.|.|||..                              ||.......::.|    
Human   428 LLSNYALTLLVIYFLQTRDPPVLPTVSQLTQKAGEGEQVEVDGWDCSFPRDASRLEPSINVEPLS 492

  Fly   462 -LLLEFF------ELYGRRFNYMKIGISIKNGGRYMPKDELQRDMVDGHRPSLLCIEDPLTPGND 519
             ||.:||      :|.|..       :|::.|........|..::.:|.|...|.::||      
Human   493 SLLAQFFSCVSCWDLRGSL-------LSLREGQALPVAGGLPSNLWEGLRLGPLNLQDP------ 544

  Fly   520 IGRSSYGVFQVQQAFKCAYRVLALAVSPLNLLGIDPRVNSILGRIIHITDDVIDY---------- 574
                          |..::.|.|...|            .:.||:.:......:|          
Human   545 --------------FDLSHNVAANVTS------------RVAGRLQNCCRAAANYCRSLQYQRRS 583

  Fly   575 ---REWIRENFEHLVVVDRISPLPTAAPTAYATANGAPKYVIMPSGAVVQQLYHHPVQVPTAHGH 636
               |:|              ..||...|::             ||..    |...|:.:|.|   
Human   584 SRGRDW--------------GLLPLLQPSS-------------PSSL----LSATPIPLPLA--- 614

  Fly   637 SHAHSHSHGHAHPGAHLCQPYVTGTTVSAVTTTTTMAVVTVGVSAGGVQQQQQQQNATAHTHSQQ 701
                               |:          |..|.|:|.|...|.|...:|    ||..|.|:.
Human   615 -------------------PF----------TQLTAALVQVFREALGCHIEQ----ATKRTRSEG 646

  Fly   702 QTQNQSQSRHRRGSTS----------------------SGDDSEDSKDGDVVETTSSAQEVV--- 741
            ....:|.    :|.||                      :||..||..:..|:|.....|:..   
Human   647 GGTGESS----QGGTSKRLKVDGQKNCCEEGKEEQQGCAGDGGEDRVEEMVIEVGEMVQDWAMQS 707

  Fly   742 -----DIALSTPNGLANMSMPMPVHAV-------GMPASNSWSGNGNGNGNSSSSTGS-SPEIAH 793
                 |:.|:|....|......|.||.       |..|:..||....|.|.|..|:.| ...:.|
Human   708 PGQPGDLPLTTGKHGAPGEEGQPSHAALAERGPKGHEAAQEWSQGEAGKGASLPSSASWRCALWH 772

  Fly   794 IAAQEMDPELEDQQQQQQHQETSGGNGFIRPGDVGT 829
            ...|  ......::.|||.:|.:||....|.|.:.|
Human   773 RVWQ--GRRRARRRLQQQTKEGAGGGAGTRAGWLAT 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 15/109 (14%)
PAP_assoc 458..518 CDD:281779 15/70 (21%)
TUT1NP_073741.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..334 23/106 (22%)
KA1, binds the bulging loops of U6 snRNA but is dispensable for terminal uridylyltransferase activity. /evidence=ECO:0000269|PubMed:28589955 598..874 57/268 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 638..662 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..761 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.