DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and MTPAP

DIOPT Version :9

Sequence 1:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_060579.3 Gene:MTPAP / 55149 HGNCID:25532 Length:582 Species:Homo sapiens


Alignment Length:417 Identity:80/417 - (19%)
Similarity:140/417 - (33%) Gaps:114/417 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 STGAGGTGTNSPATTASSTAATTTGPATSMSDTSNNPPQSTTTPASRTNSIYYNPSRKKRPENKA 235
            |.|:...||::|     |||..|..|..|.  ..|...::.|:..||..|....|...|:     
Human   123 SIGSLQNGTHTP-----STAMETAIPFRSR--FFNLKLKNQTSERSRVRSSNQLPRSNKQ----- 175

  Fly   236 GGAHYYMNNHMEMIAKYKGEPWRKPDYPYGEGVIGLHEEIEHFYQYVLPTPCEHAIRNEVVKRIE 300
                     ..|::.             |.|.:   .:::....:....|.....:|......||
Human   176 ---------LFELLC-------------YAESI---DDQLNTLLKEFQLTEENTKLRYLTCSLIE 215

  Fly   301 AVVHSIWPQAVVEIFGSFRTGLFLPTSDIDLVVLGLWEKLPLRT--------LEFELVSRGIAEA 357
            .:..:.:|..:|..|||..........|:|: .|.|.|...|..        :||::.:......
Human   216 DMAAAYFPDCIVRPFGSSVNTFGKLGCDLDM-FLDLDETRNLSAHKISGNFLMEFQVKNVPSERI 279

  Fly   358 CTVRVLD--------------------KASVPIIKLTDRETQVKVDISFNMQSGVQSAELIKKFK 402
            .|.::|.                    .|..|:::.:.:.:..:.|::.|.:..:.|:||:..:.
Human   280 ATQKILSVLGECLDHFGPGCVGVQKILNARCPLVRFSHQASGFQCDLTTNNRIALTSSELLYIYG 344

  Fly   403 RDYPVLEKLVLVLKQFLLLRDLNEVFTGG-ISSYSLILMCISFLQMHPRGIY------------- 453
            .....:..||..::.:.....|.....|. |:::||.:|.|.|||.....|.             
Human   345 ALDSRVRALVFSVRCWARAHSLTSSIPGAWITNFSLTMMVIFFLQRRSPPILPTLDSLKTLADAE 409

  Fly   454 ----------------------HDTANLGVLLLEFFELYGRRFNYMKIGISIKNGGRYMPKDELQ 496
                                  .:|..|.:||.||||.:| .|.:.|..|:|:.|......|.  
Human   410 DKCVIEGNNCTFVRDLSRIKPSQNTETLELLLKEFFEYFG-NFAFDKNSINIRQGREQNKPDS-- 471

  Fly   497 RDMVDGHRPSLLCIEDPLTPGNDIGRS 523
                     |.|.|::|.....:|.::
Human   472 ---------SPLYIQNPFETSLNISKN 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 25/137 (18%)
PAP_assoc 458..518 CDD:281779 18/59 (31%)
MTPAPNP_060579.3 NT_PAP_TUTase 206..344 CDD:143392 25/138 (18%)
PAP_assoc 440..483 CDD:281779 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.