DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and mkg-p

DIOPT Version :9

Sequence 1:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster


Alignment Length:314 Identity:77/314 - (24%)
Similarity:127/314 - (40%) Gaps:77/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 CEHAIRNEVVKRIEAVVHSIWPQAVVEIFGSFRTGLFLPTSDIDLVVLGLWEKLPL-------RT 344
            |...:||.:.|.:...|. ::|      |||..|||.|..|||||.:.....:.||       :|
  Fly   104 CFGHVRNCIEKEMRGRVR-VFP------FGSLVTGLALKESDIDLFLEPNGNQPPLFHNQLYNKT 161

  Fly   345 LEFELVSRGIAEACTVRVLDKASVPIIKLTDRETQVKVDISFNMQSGVQSAELIKKFKRDYPVLE 409
            ..|...|:..|:..|:|   .||||||:...:.|.:.:||:.:..:.:.::..:.:.......:.
  Fly   162 SHFLRRSKCFADVFTIR---HASVPIIRCKHQLTGLNIDINMSNPNSIYNSRFVGELMFRNERIR 223

  Fly   410 KLVLVLKQFLLLRDLNEVFTGGISSYSLILMCISFLQMHP-----------------RGIYHD-- 455
            :|.|.||  :..:.|..:..||::||.||.:.|..||::.                 .|:.:.  
  Fly   224 ELCLFLK--IWAKKLKLISHGGMTSYCLISLIIVNLQVNRLVPSVKELQSLCPPVILSGVNYAYS 286

  Fly   456 -------TANLGVL-LLEFFELYGRRFNYMKIGISIKNGG---------------RYMPKDELQR 497
                   .|.|..| ||:.|.:|....|:.|..:|...||               .|..:.:|..
  Fly   287 LDLTPPIPARLTTLDLLKNFFIYYCTVNFDKSVLSPFLGGCVDKETTLGMPGGFPEYDEQQKLVH 351

  Fly   498 DMVDGHRPS------LLCIEDPLTPGNDIGRSSYGVFQVQQAFKCAYR---VLA 542
            |.: |..|.      .:|::||.....::.:|      |..:..|.:|   |||
  Fly   352 DAI-GAPPDAFQLDRAMCVQDPFELSRNVAKS------VSISNLCYFRQCLVLA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 34/116 (29%)
PAP_assoc 458..518 CDD:281779 19/81 (23%)
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 35/121 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.