DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and Tent2

DIOPT Version :9

Sequence 1:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_038958452.1 Gene:Tent2 / 361878 RGDID:1306438 Length:510 Species:Rattus norvegicus


Alignment Length:192 Identity:52/192 - (27%)
Similarity:85/192 - (44%) Gaps:46/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 LDKASVPIIKLTDRETQVKVDISFNMQSGVQSAELIKKFKRDYPVLEK----LVLVLKQFLLLRD 423
            |.:|.|||:|..|:.:.|:.|::.|...|:::..|:    |.|..||.    ||||:|::....:
  Rat   285 LIRAKVPIVKFRDKVSCVEFDLNVNNTVGIRNTFLL----RTYAYLENRVRPLVLVIKKWASHHE 345

  Fly   424 LNEVFTGGISSYSLILMCISFLQMHPRGI---------------------YHDTAN--------- 458
            :|:...|.:|||||:||.:.:||..|..|                     :|...|         
  Rat   346 INDASRGTLSSYSLVLMVLHYLQTLPEPILPSLQKIYPESFSTSVQLHLVHHAPCNVPPYLSKNE 410

  Fly   459 --LGVLLLEFFELYGRRFNYMKIGISIKNGGRYMPKDELQRDMVDGHRPSLLCIEDPLTPGN 518
              ||.|||.|.:.|...|::....||::........|:::      .|...:|:|:|....|
  Rat   411 SSLGDLLLGFLKYYATEFDWNTQMISVREAKAIPRPDDME------WRNKYICVEEPFDGTN 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 12/37 (32%)
PAP_assoc 458..518 CDD:281779 16/70 (23%)
Tent2XP_038958452.1 TRF4 <224..>494 CDD:227585 52/192 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.