DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and Mtpap

DIOPT Version :9

Sequence 1:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:XP_038951672.1 Gene:Mtpap / 307050 RGDID:1310900 Length:584 Species:Rattus norvegicus


Alignment Length:397 Identity:79/397 - (19%)
Similarity:136/397 - (34%) Gaps:101/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 DTSNNPPQSTTTPASRTNSIYYNPSR-----KKRPENKAGGAHYYMNNHMEMIAKYKGEPWRKPD 261
            |:.|:....|.||...|.:.....||     .|.|.|:..|..:..       |..:..|..|..
  Rat   122 DSINSLQNGTHTPTQSTEAAIPFKSRFLNLKLKNPSNQVSGQSFVQ-------ADSQSPPSSKKL 179

  Fly   262 Y---PYGEGVIGLHEEIEHFYQYVLPTPCEHAIRNEVVKRIEAVVHSIWPQAVVEIFGSFRTGLF 323
            :   .|.|.:......:...:|.   |.....:|:.....||.:..:.:|..||..|||......
  Rat   180 FELLSYAESIDAQLTALLKAFQL---TEENVRLRHLTCSLIEDIAAAYFPSCVVWPFGSSVNTFG 241

  Fly   324 LPTSDIDLVVLGLWEKLPLR--------TLEFELVSRGIAEACTVRVLD---------------- 364
            ....|:|: .|.|.|...|.        .:||::.:.......|.::|.                
  Rat   242 KLGCDLDM-FLDLDETGNLSDHKNTGNFLMEFQVKNVPSERVATQKILSVIGECLDNFGPGCVGV 305

  Fly   365 ----KASVPIIKLTDRETQVKVDISFNMQSGVQSAELIKKFKRDYPVLEKLVLVLKQFLLLRDLN 425
                .|..|:::.:.:.:..:.|::.|....::|:||:..:......:..||..::.:.....|.
  Rat   306 QKILNARCPLVRFSHQGSGFQCDLTANNSIALKSSELLYIYGSLDSRVRALVFGVRCWARAHSLT 370

  Fly   426 EVFTGG-ISSYSLILMCISFLQ--------------------------------------MHPRG 451
            ....|. |:::||.:|.|.|||                                      :.|.|
  Rat   371 SSIPGAWITNFSLTMMVIFFLQRRSPPILPTLDSLKSMADAEDRCILEGNNCTFIQDINKIKPSG 435

  Fly   452 IYHDTANLGVLLLEFFELYGRRFNYMKIGISIKNGGRYMPKDELQRDMVDGHRPSLLCIEDPLTP 516
               :|..|.:||.||||.:| .|.:.|..|:|:.|......|.           |.|.|::|...
  Rat   436 ---NTETLELLLKEFFEYFG-NFAFNKNSINIRQGREQNKPDS-----------SPLYIQNPFET 485

  Fly   517 GNDIGRS 523
            ..:|.::
  Rat   486 SLNISKN 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 26/137 (19%)
PAP_assoc 458..518 CDD:281779 18/59 (31%)
MtpapXP_038951672.1 RL 63..132 CDD:407669 2/9 (22%)
TRF4 184..>496 CDD:227585 64/328 (20%)
NT_PAP_TUTase 209..347 CDD:143392 26/138 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.