DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and cid12

DIOPT Version :9

Sequence 1:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_588273.1 Gene:cid12 / 2539423 PomBaseID:SPCC663.12 Length:336 Species:Schizosaccharomyces pombe


Alignment Length:335 Identity:93/335 - (27%)
Similarity:166/335 - (49%) Gaps:36/335 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 PYGEGVIGLHEEIEHFYQYVLPTPCEHAIRNEVVKRIEAVVHSIWPQAVVEIFGSFRTGLFLPTS 327
            |:.|..:..:..:..|.::|.|...|...|..::::::..:..:...|.::::||...|..|..|
pombe    12 PWNEEGLSDNARLYSFLEFVSPKIEELKYRKLLLEKLQTHIREVVLDAELQVYGSMYIGTTLSIS 76

  Fly   328 DIDLVVLGLWEKLPLRTLEFE-----LVSRGIAEACTVRVLDKASVPIIKLTDRETQVKVDISFN 387
            |:|:.:     |.| |..|.|     :|.|...:| .......|.||.|.|.| .:.:.||::|.
pombe    77 DVDVSL-----KSP-RVGELEKRRVTMVLRKYLDA-DADFHSSARVPRINLVD-VSGIGVDLTFG 133

  Fly   388 MQSGVQSAELIKKFKRDYPVLEKLVLVLKQFLLLRDLNEVFTGGISSYSLILMCISFLQM--HPR 450
            .....::|||.|.:..::|:..:|:::||.:|..|||..|..|||:|.:|..|.|.:|:|  |.:
pombe   134 NDKACRTAELQKAYNEEHPIFGRLLMLLKHWLFERDLENVHHGGIASCALSYMLIGWLEMRFHKK 198

  Fly   451 GIYHDTANLGVLLLEFFELYGRRFNYMKIGISIKNGGRYMPKDELQRDMVDGHRPSLLCIEDPLT 515
            ||..:...:..||.:||..:|..:.| ::.:.....|:.:||  ||:..::..:|:||.||||:.
pombe   199 GIDSEVQPIRALLQKFFYFWGVEWTY-ELFVLRPLTGQIVPK--LQKGWLNEVQPNLLSIEDPID 260

  Fly   516 PGNDIGRSSYGVFQVQQAFKCAYRVLALAVSPLNLLGIDPRVNSILGRIIHITDDVIDYREWIRE 580
            ..||||:.|:.:..::.||          |:..|.|..|....|...    ||:|.:    ::.:
pombe   261 RNNDIGKQSFQISMIKAAF----------VASANELLSDKTWFSTFA----ITEDEM----FLCK 307

  Fly   581 NFEHLVVVDR 590
            .||:::...|
pombe   308 QFENVINTKR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 30/114 (26%)
PAP_assoc 458..518 CDD:281779 18/59 (31%)
cid12NP_588273.1 TRF4 1..336 CDD:227585 93/335 (28%)
NT_PAP_TUTase 41..147 CDD:143392 30/113 (27%)
PAP_assoc 206..263 CDD:281779 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23092
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2219
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.