DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and ven-1

DIOPT Version :10

Sequence 1:NP_572490.2 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_506597.2 Gene:ven-1 / 179957 WormBaseID:WBGene00006891 Length:86 Species:Caenorhabditis elegans


Alignment Length:38 Identity:10/38 - (26%)
Similarity:15/38 - (39%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 LEKLVLVLKQFLLLRDLNEVFTGGISSYS----LILMC 441
            |..:|.....|::|.....|...||.:.|    :|..|
 Worm     4 LSVIVFFFTSFVILVSCYNVPPTGIPAVSEVDTMIRQC 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_572490.2 TRF4 271..>583 CDD:227585 10/38 (26%)
ven-1NP_506597.2 None

Return to query results.
Submit another query.