DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and TENT2

DIOPT Version :9

Sequence 1:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001336478.1 Gene:TENT2 / 167153 HGNCID:26776 Length:509 Species:Homo sapiens


Alignment Length:455 Identity:102/455 - (22%)
Similarity:169/455 - (37%) Gaps:149/455 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 NSPATTASSTAATTTGPATSMSDTSNNPPQSTTTPASRTNSIYYNPSRKKRPENK----AGGAHY 240
            |:..:.|.|....|.|        :.:|.|::.:|..|        .||:..:.|    .|....
Human    44 NADLSRAVSLQQLTYG--------NVSPIQTSASPLFR--------GRKRLSDEKNLPLDGKRQR 92

  Fly   241 YMNNHME-----MIAKYKGEPWRK------------PDY-----PYGE------GVIGLHEEIEH 277
            :.:.|.|     .|....||  |:            ||.     |:.|      ..|.|.|..:.
Human    93 FHSPHQEPTVVNQIVPLSGE--RRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDK 155

  Fly   278 FYQYVLP--TPCEHAI----RNEVVK-RIEAVVHSIWPQAVVEIFGSFRTGLFLPTSDIDLV--- 332
            ..|.:|.  ..|:..|    :.|:.: :::..:..::||:.:.:.||...|....:||.||.   
Human   156 LSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLVGSSLNGFGTRSSDGDLCLVV 220

  Fly   333 -----------------VLGLWEK-------------------LPLRTLEFELVSRGIAEACTVR 361
                             :|.|..|                   :.|..:...|.|.|..|.   .
Human   221 KEEPCFFQVNQKTEARHILTLVHKHFCTRLCKSDMPQVCMSPDVTLLKMPLTLSSAGYIER---P 282

  Fly   362 VLDKASVPIIKLTDRETQVKVDISFNMQSGVQSAELIKKFKRDYPVLEK----LVLVLKQFLLLR 422
            .|.:|.|||:|..|:.:.|:.|::.|...|:::..|:    |.|..||.    ||||:|::....
Human   283 QLIRAKVPIVKFRDKVSCVEFDLNVNNIVGIRNTFLL----RTYAYLENRVRPLVLVIKKWASHH 343

  Fly   423 DLNEVFTGGISSYSLILMCISFLQMHP-------RGIYHDT------------------------ 456
            .:|:...|.:|||||:||.:.:||..|       :.||.::                        
Human   344 QINDASRGTLSSYSLVLMVLHYLQTLPEPILPSLQKIYPESFSPAIQLHLVHQAPCNVPPYLSKN 408

  Fly   457 -ANLGVLLLEFFELYGRRFNYMKIGISIKNGGRYMPKDELQRDMVDG--HRPSLLCIEDPLTPGN 518
             :|||.|||.|.:.|...|::....||::. .:.:|:.       ||  .|...:|:|:|....|
Human   409 ESNLGDLLLGFLKYYATEFDWNSQMISVRE-AKAIPRP-------DGIEWRNKYICVEEPFDGTN 465

  Fly   519  518
            Human   466  465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 31/153 (20%)
PAP_assoc 458..518 CDD:281779 18/61 (30%)
TENT2NP_001336478.1 TRF4 154..>493 CDD:227585 76/327 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.