DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf4-1 and Tent2

DIOPT Version :9

Sequence 1:NP_001259340.1 Gene:Trf4-1 / 31795 FlyBaseID:FBgn0030049 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001348466.1 Gene:Tent2 / 100715 MGIID:2140950 Length:484 Species:Mus musculus


Alignment Length:398 Identity:91/398 - (22%)
Similarity:157/398 - (39%) Gaps:104/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 NPPQSTTTPASRTNSIYYNPSRKKRPENKA----GGAHYYMNNHMEMI-----------AKYKGE 255
            :|.|::|:|..|        .||:..:.||    |....:.:.|.|..           .:|...
Mouse    62 SPIQTSTSPLFR--------GRKRISDEKAFPLDGKRQRFHSPHQEPTIINQLVPLSGDRRYSMP 118

  Fly   256 PWRKPDY---------PYGE------GVIGLHEEIEHFYQYVLP--TPCEHAI----RNEVVK-R 298
            |.....|         |..|      ..|.|.|..:...|.:|.  ..|:...    :.|:.: :
Mouse   119 PLFHTHYIPDIVRCVPPLREIPLLEPREITLPEAKDKLSQQILELFETCQQQASDLKKKELCRAQ 183

  Fly   299 IEAVVHSIWPQAVVEIFGSFRTGLFLPTSDIDLVVLGLWE----KLPLRTLEFELVSRGIAEACT 359
            ::..:..::||:.:.:.||...|....:||.||.::...|    ::..:|....:::......||
Mouse   184 LQREIQLLFPQSRLFLVGSSLNGFGARSSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCT 248

  Fly   360 VRV--------LDKASVPIIKLTDRETQVKVDISFNMQSGVQSAELIKKFKRDYPVLEK----LV 412
             |:        |.:|.|||:|..|:.:.|:.|::.|...|:::..|:    |.|..||.    ||
Mouse   249 -RLSGYIERPQLIRAKVPIVKFRDKVSCVEFDLNVNNTVGIRNTFLL----RTYAYLENRVRPLV 308

  Fly   413 LVLKQFLLLRDLNEVFTGGISSYSLILMCISFLQMHPRGI---------------------YHDT 456
            ||:|::....|:|:...|.:|||||:||.:.:||..|..|                     :|..
Mouse   309 LVIKKWASHHDINDASRGTLSSYSLVLMVLHYLQTLPEPILPSLQKIYPESFSTSVQLHLVHHAP 373

  Fly   457 AN-----------LGVLLLEFFELYGRRFNYMKIGISIKNGGRYMPKDELQRDMVDGHRPSLLCI 510
            .|           ||.|||.|.:.|...|::....||::........|:::      .|...:|:
Mouse   374 CNVPPYLSKNESSLGDLLLGFLKYYATEFDWNTQMISVREAKAIPRPDDME------WRNKYICV 432

  Fly   511 EDPLTPGN 518
            |:|....|
Mouse   433 EEPFDGTN 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf4-1NP_001259340.1 NT_PAP_TUTase 291..401 CDD:143392 27/126 (21%)
PAP_assoc 458..518 CDD:281779 16/70 (23%)
Tent2NP_001348466.1 Nuclear localization signal. /evidence=ECO:0000255 76..92 4/15 (27%)
TRF4 121..>468 CDD:227585 77/331 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.