DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and SYM1

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_013352.1 Gene:SYM1 / 850953 SGDID:S000004241 Length:197 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:47/169 - (27%)
Similarity:81/169 - (47%) Gaps:7/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TNTIGSGLLLAIGDAIAQ-QYERFGEKKAFDYSRSGCMMITGSVI-GPIQHGFYLLLDGVL---- 102
            ||.|.:|.|..|||..|| .:......|.:||.|:...:|.||:| ..|...:|.:|:..:    
Yeast    18 TNAIMTGALFGIGDVSAQLLFPTSKVNKGYDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRN 82

  Fly   103 -PGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCFWPGL 166
             |......::.::.||||..:|:.:..:|...|::.|:||.....::.|::..|.:.:...||..
Yeast    83 RPQYHWSNMVLRVAVDQLAFAPLGLPFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLF 147

  Fly   167 QYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKYGVSNHD 205
            |.:||..:...:|::.|||....:...||:....|...|
Yeast   148 QAINFSVVPLQHRLLAVNVVAIFWNTYLSYKNSKVMEKD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 16/62 (26%)
SYM1NP_013352.1 Mpv17_PMP22 115..176 CDD:397992 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.