DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and MPV17L2

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_116072.2 Gene:MPV17L2 / 84769 HGNCID:28177 Length:206 Species:Homo sapiens


Alignment Length:166 Identity:65/166 - (39%)
Similarity:92/166 - (55%) Gaps:4/166 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GKYLLLTNTIGSGLLLAIGDAIAQQYE-RFGEKKAFDYSRSGCMMITGSVIGPIQHGFYLLLDGV 101
            |:.||:|||:|.|.|:|.||.:.|.:| |....:.||..||..|...|..:||..|.:||.||.:
Human    22 GRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPFLHYWYLSLDRL 86

  Fly   102 LP--GTSGW-GVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCFW 163
            .|  |..|: .||.|:|||||:.||:....:|.....|.|::..|...||.|||...:..|.|.|
Human    87 FPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGCLEGQTVGESCQELREKFWEFYKADWCVW 151

  Fly   164 PGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKY 199
            |..|::||.|:...:||.::|.....:...||::||
Human   152 PAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 21/62 (34%)
MPV17L2NP_116072.2 Mpv17_PMP22 122..183 CDD:397992 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8893
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4626
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm41280
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - O PTHR11266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.