DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and AT1G52870

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_564615.3 Gene:AT1G52870 / 841720 AraportID:AT1G52870 Length:366 Species:Arabidopsis thaliana


Alignment Length:178 Identity:44/178 - (24%)
Similarity:81/178 - (45%) Gaps:14/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 APPPNAKFWTKLFGKYLLLTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGCM---MITGSV 86
            ||..|...:.:...:..:|...:.||::.::||.|||.||   .|..|:..|:..:   ::..::
plant   165 APQHNWIAYEEALKQNPVLAKMVISGVVYSVGDWIAQCYE---GKPLFEIDRARTLRSGLVGFTL 226

  Fly    87 IGPIQHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEK 151
            .|.:.|.:|...:.:.|....|.|..|:..||.:.|.|:..::|.|...|..:|.:....||...
plant   227 HGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWNSIYFTVLGFLRFESPISIFKELKAT 291

  Fly   152 FL----YTWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLS 195
            ||    ..|.|    ||....:.:..:....|:::|:....::|.:||
plant   292 FLPMLTAGWKL----WPFAHLITYGLVPVEQRLLWVDCVELIWVTILS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 15/65 (23%)
AT1G52870NP_564615.3 Mpv17_PMP22 274..335 CDD:397992 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.