DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and AT5G43140

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_568621.1 Gene:AT5G43140 / 834331 AraportID:AT5G43140 Length:254 Species:Arabidopsis thaliana


Alignment Length:172 Identity:37/172 - (21%)
Similarity:80/172 - (46%) Gaps:8/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 STAPPPNAKFWTKLFGKYLLLTNTIGSGLLLAIGDAIAQQ--YERFGEKKAFDYSRSGCMMITGS 85
            |:..|...:::.:....:..:|.:|.:.::....|..:|.  .|..|   :||..|:..|...|.
plant    72 SSKQPAFLRWYLRKLESHPFMTKSITTSVIYMAADLTSQMITMEPTG---SFDLIRTARMASFGL 133

  Fly    86 V-IGPIQHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELS 149
            : :||.||.::..|..:||.........||::.|::..|:...:|:..::.|.|::..|..:.|.
plant   134 IFLGPSQHLWFSYLSKILPKRDVLTTFKKIMMGQVLFGPVSNTVFYSYNAALQGENSEEIVARLK 198

  Fly   150 EKFLYTWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYV 191
            ...|.|......:||...::.|::: .::....:| ::|.|:
plant   199 RDLLPTLKNGLMYWPVCDFVTFKYV-PVHLQPLMN-SSCAYI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 12/57 (21%)
AT5G43140NP_568621.1 Mpv17_PMP22 185..248 CDD:282035 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.