DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and AT2G42770

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_565983.1 Gene:AT2G42770 / 818877 AraportID:AT2G42770 Length:232 Species:Arabidopsis thaliana


Alignment Length:177 Identity:47/177 - (26%)
Similarity:78/177 - (44%) Gaps:29/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LTNTIGSGLLLAIGDAIAQQYERFGEKKAF-------------------DYSRSGCMMITGSVI- 87
            |...:.:|.|...||.|||...|:.::.|.                   |:.|:..|...|.:: 
plant    56 LKQAVTAGALTFTGDTIAQLSGRWKKRTALKQSSSELDEGELWNIFSEHDWIRALRMSSYGFLLY 120

  Fly    88 GPIQHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKF 152
            ||..:.:|..||..||..:...::.|:|::|:|:.|..|.:.|..::|..||.     |||..|:
plant   121 GPGSYAWYQFLDHSLPKPTATNLVLKVLLNQVILGPSVIAVIFAWNNLWLGKL-----SELGNKY 180

  Fly   153 ----LYTWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLS 195
                |.|.:....||..:..|||..:....||.|:::.:..:...||
plant   181 QKDALPTLLYGFRFWVPVSILNFWVVPLQARVAFMSMGSVFWNFYLS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 19/65 (29%)
AT2G42770NP_565983.1 Mpv17_PMP22 173..227 CDD:397992 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.