DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and AT2G14860

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_179092.1 Gene:AT2G14860 / 815975 AraportID:AT2G14860 Length:252 Species:Arabidopsis thaliana


Alignment Length:184 Identity:38/184 - (20%)
Similarity:77/184 - (41%) Gaps:12/184 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FSTAPPPNAKFWTKLFGKYL-------LLTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGC 79
            ||::..|:.   ....|.||       ::|.::.|.|:....|..:|...: ...:::|..|:..
plant    62 FSSSSSPSR---IGFVGWYLGMVKSHPVVTKSVTSSLIYIAADLSSQTIAK-TSSESYDLVRTAR 122

  Fly    80 MMITG-SVIGPIQHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVE 143
            |...| .|:||..|.::..:..:.|.........|:.:.|.|..||...:||.:::.|.|:....
plant   123 MGGYGLFVLGPTLHYWFNFMSRLFPKQDLITTFKKMAMGQTIYGPIMTVIFFSLNASLQGERGSV 187

  Fly   144 CNSELSEKFLYTWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHI 197
            ..:.|....|........:||...::.|||.....:.:..|..:.|:.:.::::
plant   188 ILARLKRDLLPALFNGVMYWPLCDFITFRFFPVHLQPLVSNSFSYVWTIYMTYM 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 11/63 (17%)
AT2G14860NP_179092.1 Mpv17_PMP22 180..243 CDD:282035 11/62 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.