DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and mpv17l2

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001004930.1 Gene:mpv17l2 / 448319 XenbaseID:XB-GENE-1002324 Length:222 Species:Xenopus tropicalis


Alignment Length:173 Identity:64/173 - (36%)
Similarity:96/173 - (55%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKFWTKLF-GKYLLLTNTIGSGLLLAIGDAIAQQYE--RFGEKKAFDYSRSGCMMITGSVIGPIQ 91
            |.:|...| |::|::|||:..||||.|||:|.|..|  |..|:|. |:.|:|.|...|..:||:.
 Frog    13 AGYWKPFFKGRFLIVTNTVSCGLLLGIGDSIQQSREVRRDPERKR-DWLRTGRMFAIGCSMGPLM 76

  Fly    92 HGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTW 156
            |.:|..||...||.....|:.|:|:|||:.||:....:|.....:.|:...:...|..|||...:
 Frog    77 HFWYSWLDRSFPGRGITVVMRKVLIDQLVASPVLGLWYFLGMGSMEGQKLEKSWQEFREKFWEFY 141

  Fly   157 MLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKY 199
            ..|...||..|.:||.||:..|||:::||....:...||::|:
 Frog   142 KADWTVWPAAQMINFYFLSPKYRVIYINVITVGWDTYLSYLKH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 20/62 (32%)
mpv17l2NP_001004930.1 Mpv17_PMP22 119..180 CDD:367825 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7958
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - mtm9505
Panther 1 1.100 - - O PTHR11266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.