DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and mpv17l2

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001002567.1 Gene:mpv17l2 / 436840 ZFINID:ZDB-GENE-040718-306 Length:199 Species:Danio rerio


Alignment Length:172 Identity:64/172 - (37%)
Similarity:94/172 - (54%) Gaps:2/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKFWTKLF-GKYLLLTNTIGSGLLLAIGDAIAQQYE-RFGEKKAFDYSRSGCMMITGSVIGPIQH 92
            |.:|..|| |::|::|||:..|.:||.||.|.|..| |....:..|:||:|||...|..:||..|
Zfish    14 AGYWKPLFRGRFLIVTNTVSCGGMLAAGDLIQQTREIRRTPGRTRDWSRTGCMFAVGCSMGPFMH 78

  Fly    93 GFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWM 157
            .:|..||....|.....|..|:|||||:.||.....:|....::.|.:|:|...|..:||...:.
Zfish    79 YWYQWLDKYFIGNGINNVCKKVLVDQLVASPTLGAWYFLGMGMMEGHTFIEAQQEFRDKFWEFYK 143

  Fly   158 LDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKY 199
            .|.|.||..|.:||.||...:||::||:....:...||::|:
Zfish   144 ADWCVWPAAQMINFYFLPPKFRVLYVNIVTLGWDTYLSYLKH 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 21/62 (34%)
mpv17l2NP_001002567.1 Mpv17_PMP22 121..185 CDD:282035 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9206
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - O PTHR11266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.