DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and mpv17

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_957459.2 Gene:mpv17 / 394140 ZFINID:ZDB-GENE-040426-1168 Length:177 Species:Danio rerio


Alignment Length:171 Identity:49/171 - (28%)
Similarity:82/171 - (47%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKFWTK---LFGKYLLLTNTIGSGLLLAIGDAIAQQ-YERFGEKKAFDYSRSGCMMITG-SVIGP 89
            |..|..   |..|:......|.:|.|:.:||.|:|| .||.|... .:..|:..||..| ..:||
Zfish     2 AGLWRSYQALMAKHPWKVQIITAGSLVGVGDVISQQLIERRGLAN-HNARRTAKMMSIGFFFVGP 65

  Fly    90 IQHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLY 154
            :..|:|.:||.::.|.:....|.|:||||:..:|.::..|..::..|.|.:..|..::|...:..
Zfish    66 VVGGWYKVLDKLVTGGTKSAALKKMLVDQVGFAPCFLGAFLGITGTLNGLTVEENVAKLQRDYTD 130

  Fly   155 TWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLS 195
            ..:.:...||.:|..||.|:...:|:..|.:...|:...||
Zfish   131 ALISNYYLWPPVQIANFYFIPLHHRLAVVQIVAVVWNSYLS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 15/61 (25%)
mpv17NP_957459.2 Mpv17_PMP22 112..175 CDD:282035 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.