DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and CG5906

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster


Alignment Length:197 Identity:65/197 - (32%)
Similarity:98/197 - (49%) Gaps:19/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTRLANPLKMSCQLVTHFSTAPPPNAKFWTKLFGKYLLLTNT-IGSGLLLAIGDAIAQQYER-FG 67
            |.|:.|.:....|:.  ||.              ||||.||. |..||.: :||.:.|.||| .|
  Fly     7 WRRMTNAMDRFHQIA--FSP--------------KYLLFTNIGISVGLSM-VGDTMEQSYERLIG 54

  Fly    68 EKKAFDYSRSGCMMITGSVIGPIQHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYV 132
            |...::.:|:..|.|:|..:|.:.|.:|..||.:.|..:...|:.|||:||.|.||.||.:||..
  Fly    55 ELPDWNRTRTIRMGISGLTVGLVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLT 119

  Fly   133 SSLLGGKSFVECNSELSEKFLYTWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHI 197
            .::|...::.|...|:.||.|..:..:...||..|::||..:...|||.:.|..:..|.:..|.:
  Fly   120 MAILEDNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQV 184

  Fly   198 KY 199
            ||
  Fly   185 KY 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 17/62 (27%)
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463135
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104780at33392
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm3031
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.