DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and CG7970

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001303378.1 Gene:CG7970 / 38205 FlyBaseID:FBgn0035252 Length:255 Species:Drosophila melanogaster


Alignment Length:173 Identity:41/173 - (23%)
Similarity:77/173 - (44%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LFGKYL-------LLTNTIGSGLLLAIGDAIAQQY---ERFGEKKAFDYSRSGCMMITGSVIGPI 90
            |||.||       :.|.:|.:.:|....:..:|:.   :...::..|.|...|  :|.|   |.:
  Fly    74 LFGTYLEQLFNHPVRTKSITACVLATSANVTSQRLAGAKTLNQQSVFAYGLFG--LIFG---GSV 133

  Fly    91 QHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYT 155
            .|.||..::.:......:......|.::|:.:|||..|..:..:|..|||.......:.:  || 
  Fly   134 PHYFYTTVERLFSQDVRFRRFFLFLSERLVYAPIYQALSLFFLALFEGKSPSTALKNVEK--LY- 195

  Fly   156 WMLDCCFWPGLQ---YLNFRFLNSLYRVVFVNVANCVYVVLLS 195
            |.|....|..|.   ||||.::..::|.:.:.:.:.::||.::
  Fly   196 WPLLKANWQYLSVFVYLNFAYVPPMFRSISMAIISFIWVVYIA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 17/64 (27%)
CG7970NP_001303378.1 Mpv17_PMP22 178..238 CDD:282035 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463137
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.