DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and AT4G14305

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001031637.1 Gene:AT4G14305 / 3770487 AraportID:AT4G14305 Length:185 Species:Arabidopsis thaliana


Alignment Length:170 Identity:51/170 - (30%)
Similarity:82/170 - (48%) Gaps:22/170 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KYL-------LLTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGCMMITGSVI-GPIQHGFY 95
            |||       |.|..|.:|:|....|||||   :....|...:.|...:|:.|... ||..|.|:
plant    11 KYLIQLQAHPLRTKAITAGVLAGCSDAIAQ---KISGVKRIQFRRLLLLMLYGFAYGGPFGHFFH 72

  Fly    96 LLLDGVLPGTSGWG-VLHKILVDQLIMSPIYIFLFF-YVSSLLGGKSFVECNSELSEKF----LY 154
            .|:|.:..|..|.. |..|:|::||..||...|||. |...::.|:.:.....:|.:.:    |.
plant    73 KLMDTIFKGKKGNSTVAKKVLLEQLTSSPWNNFLFMSYYGLVVEGRPWKLVKHKLGKDYPTIQLT 137

  Fly   155 TWMLDCCFWPGLQYLNFRFLNSLYRVVFVN-VANCVYVVL 193
            .|.    |||.:.::|::::...:||:|.: ||:|..:.|
plant   138 AWK----FWPIVGWVNYQYVPLQFRVLFSSFVASCWSIFL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 15/64 (23%)
AT4G14305NP_001031637.1 Mpv17_PMP22 114..174 CDD:397992 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.