DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and Mpv17

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_038968365.1 Gene:Mpv17 / 360463 RGDID:1310512 Length:207 Species:Rattus norvegicus


Alignment Length:161 Identity:44/161 - (27%)
Similarity:82/161 - (50%) Gaps:10/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGCMMITGSV----IGPIQHGFYLLLDGVLP 103
            :|:...:|.|:.:||.|:||   ..|::.....::|..:...|:    :||:..|:|.:||.::|
  Rat    48 ITHVPCTGSLMGLGDIISQQ---LVERRGLQQHQTGRTLTMASLGCGFVGPVVGGWYRVLDHLIP 109

  Fly   104 GTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCFWPGLQY 168
            ||:....|.|:|:||...:|.::..|..:..:|.|.|..:..::|...:....:.:...||.:|.
  Rat   110 GTTKVNALKKMLLDQGGFAPCFLGCFLPLVGVLNGMSAQDNWAKLKRDYPDALITNYYLWPAVQL 174

  Fly   169 LNFRFLNSLYRVVFVNVANCVYVVLLSHIKY 199
            .||..:...||:.   |..||.||..|::.:
  Rat   175 ANFYLVPLHYRLA---VVQCVAVVWNSYLSW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 17/62 (27%)
Mpv17XP_038968365.1 Mpv17_PMP22 140..201 CDD:397992 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.