DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and T18D3.9

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001024916.1 Gene:T18D3.9 / 3564939 WormBaseID:WBGene00011826 Length:181 Species:Caenorhabditis elegans


Alignment Length:180 Identity:43/180 - (23%)
Similarity:74/180 - (41%) Gaps:19/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LFGKYLLLTNTIG-----SGLLLAIGDAIA------QQYERFGEKKAFDYSRSGCMMITGSVIGP 89
            ||.:..|.||.:.     :|.:...||.:|      |:::|:...: |.: .|.|.|.....|  
 Worm     5 LFIRRRLATNPLSTQMCIAGTISGSGDCLAQYLSHNQEWDRWRTAR-FSF-LSSCFMAPSLFI-- 65

  Fly    90 IQHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLY 154
                ::.||:.|........::.|:.:|||..||.:.....:...||..:|..:....|.|.:..
 Worm    66 ----WFRLLEKVKGNNKSLLLVKKLCIDQLCFSPCFNAAILFNLRLLQHQSAEKSWDLLKEDWFN 126

  Fly   155 TWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKYGVSNH 204
            .:......||.:|.:|..|:...|||:...|....:...||:|.....:|
 Worm   127 IYATSLKVWPFVQVVNLCFVPLNYRVILNQVVAFFWNCYLSYITQKPIDH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 16/62 (26%)
T18D3.9NP_001024916.1 Mpv17_PMP22 107..171 CDD:282035 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.