DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and CG1662

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster


Alignment Length:167 Identity:61/167 - (36%)
Similarity:96/167 - (57%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KYLLLTNTIGSGLLLA-IGDAIAQQYERF-GEKKAFDYSRSGCMMITGSVIGPIQHGFYLLLDGV 101
            ::||.|| :|..|.|: :||.:.|..|.: ||.:.|:.:|:..|.|:|..:|.|.|.:|.:||..
  Fly    73 RFLLFTN-VGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHYWYKMLDKR 136

  Fly   102 LPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCFWPGL 166
            :||.:...|..||::||||.|||||..||....||..|:..|...|:.||....:..:...||..
  Fly   137 MPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVA 201

  Fly   167 QYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKYGVSN 203
            |::||.::.:.||:.:.|:.:..|.||.|.:|:..|:
  Fly   202 QFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQSH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 19/62 (31%)
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463134
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104780at33392
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm3031
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - P PTHR11266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.