DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and CG14778

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster


Alignment Length:171 Identity:43/171 - (25%)
Similarity:84/171 - (49%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KYLLLTNTIGSGLLLAIGDAIAQQYE--RFGEKKAFDYSR-SGCMMITGSVIGPIQHGFYLLLDG 100
            :|.::...|...|:...|..|.|..|  |:|   .:|:.| ....|..|..:.|..:|:..:...
  Fly    16 RYPIMRGMISYSLIWPTGSLIQQTVEGRRWG---TYDWWRVLRFSMYGGLFVAPTLYGWVKISSA 77

  Fly   101 VLPGTS-GWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCFWP 164
            :.|.|| ..||: |..|:.:..:|..:..|:::.|||..|:..:..:|:.:|||.|:.:....||
  Fly    78 MWPQTSLRTGVI-KAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALSVWP 141

  Fly   165 GLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKYGVSNHD 205
            .:..:||..:....||.|::..:..:...|:::|: :.:|:
  Fly   142 LVATINFTLIPERNRVPFISACSLCWTCFLAYMKH-LEHHE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 16/62 (26%)
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463143
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.