DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and Mpv17l2

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_008769309.1 Gene:Mpv17l2 / 290645 RGDID:1308064 Length:206 Species:Rattus norvegicus


Alignment Length:171 Identity:66/171 - (38%)
Similarity:93/171 - (54%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GKYLLLTNTIGSGLLLAIGDAIAQQYE-RFGEKKAFDYSRSGCMMITGSVIGPIQHGFYLLLDGV 101
            |:.||:|||:|.|:|:|.||...|.:| |...::.|...||..|...|..:||..|.:||.||.:
  Rat    22 GRALLVTNTLGCGVLMATGDGARQAWEVRARPEQRFSARRSASMFAVGCSMGPFLHFWYLWLDRL 86

  Fly   102 LPGTSGW----GVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCF 162
            || .||.    .|:.|:||||.:.|||....:|.....|.|::..|...||..||...:..|.|.
  Rat    87 LP-ASGLRSLPSVMKKVLVDQTVASPILGVWYFLGLGSLEGQTLEESCQELRAKFWDFYKADWCV 150

  Fly   163 WPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKYGVSN 203
            ||..|.:||.|:.|.:||.::|.....:...||::||.||:
  Rat   151 WPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLKYWVSS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 21/62 (34%)
Mpv17l2XP_008769309.1 Mpv17_PMP22 124..186 CDD:282035 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4682
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm45408
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - O PTHR11266
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.