DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and Pxmp2

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_033019.2 Gene:Pxmp2 / 19301 MGIID:107487 Length:193 Species:Mus musculus


Alignment Length:161 Identity:46/161 - (28%)
Similarity:89/161 - (55%) Gaps:4/161 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YLLLTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGCM--MITG-SVIGPIQHGFYLLLDGV 101
            |.:||..:.||:|.|:|:.:||..|: .:|.:.:...||.:  ::.| .|.||:.|..||.::..
Mouse    32 YPVLTKAVSSGILSALGNLLAQTIEK-RKKDSQNLEVSGLLRYLVYGLFVTGPLSHYLYLFMEYS 95

  Fly   102 LPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCFWPGL 166
            :|....|..:.::|:|:|..:|.::.|||:|.:||.||:.....:::...|.....::...|..|
Mouse    96 VPPEVPWASVKRLLLDRLFFAPTFLLLFFFVMNLLEGKNVSVFVAKMRSGFWPALQMNWRMWTPL 160

  Fly   167 QYLNFRFLNSLYRVVFVNVANCVYVVLLSHI 197
            |::|..::...:||:|.|:|...:...|:.:
Mouse   161 QFININYVPLQFRVLFANMAALFWYAYLASL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 15/63 (24%)
Pxmp2NP_033019.2 Mpv17_PMP22 129..191 CDD:282035 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.