DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and ZK470.1

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_508708.3 Gene:ZK470.1 / 191323 WormBaseID:WBGene00022744 Length:180 Species:Caenorhabditis elegans


Alignment Length:167 Identity:52/167 - (31%)
Similarity:81/167 - (48%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KYLLLTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGCMMITGSVIGPIQHGFYLLLD-GVL 102
            ::|||||...|...:...|.|.|......::..:|:.|:..|...|.|:.|..|.||.:|| ...
 Worm    11 RHLLLTNVGTSCAQIGTADIIQQHINGDVDRDGWDWRRTCRMAAIGLVMAPSLHCFYRVLDTRKF 75

  Fly   103 PGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCFWPGLQ 167
            .|:....||.|:..|...: |.:..:|..|.|:..|||.....:|...|..:.|.:|...||..|
 Worm    76 IGSRNCKVLKKLAWDTAFI-PYFSCIFMTVGSIYEGKSLSAAFAEYRRKMWHIWKVDFTLWPPAQ 139

  Fly   168 YLNFRFLNSLYRVVFVNVANCVYVVLLSHIKYGVSNH 204
            .:||.|:....|||:||:.:.:|..::|:||....:|
 Worm   140 LINFYFMPPALRVVYVNLVSLLYNCIMSYIKNNELHH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 20/62 (32%)
ZK470.1NP_508708.3 Nuc-transf <27..>54 CDD:294849 6/26 (23%)
Mpv17_PMP22 109..171 CDD:282035 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8089
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm14683
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - O PTHR11266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.