DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and Mpv17

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001297457.1 Gene:Mpv17 / 17527 MGIID:97138 Length:178 Species:Mus musculus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:83/169 - (49%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KYLLLTNTIGSGLLLAIGDAIAQQYERFGEKKAFDYSRSGCMMITGSV----IGPIQHGFYLLLD 99
            |..:||    :|.|:.:||.|:||   ..|::.....::|..:...|:    :||:..|:|.:||
Mouse    17 KVQVLT----AGSLMGVGDMISQQ---LVERRGLQQHQAGRTLTMVSLGCGFVGPVVGGWYKVLD 74

  Fly   100 GVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKS----FVECNSELSEKFLYTWMLDC 160
            .::|||:....|.|:|:||...:|.::..|..:..:|.|.|    :.:...:..:..:..:.:. 
Mouse    75 HLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQDNWAKLKRDYPDALITNYYVR- 138

  Fly   161 CFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSHIKY 199
             .||.:|..||..:...||:.   |..||.:|..|::.:
Mouse   139 -LWPAVQLANFYLVPLHYRLA---VVQCVAIVWNSYLSW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 15/66 (23%)
Mpv17NP_001297457.1 Mpv17_PMP22 110..176 CDD:282035 15/69 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.