DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32263 and ZK470.14

DIOPT Version :9

Sequence 1:NP_728903.1 Gene:CG32263 / 317944 FlyBaseID:FBgn0052263 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001257006.1 Gene:ZK470.14 / 13220194 WormBaseID:WBGene00219362 Length:368 Species:Caenorhabditis elegans


Alignment Length:97 Identity:27/97 - (27%)
Similarity:44/97 - (45%) Gaps:12/97 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 QLIMSPIYIFLFFYVSSLLGGKSFVECNSELS----EKFLYTWMLDCCFWPGLQYLNFRFLNSLY 178
            |.||. :||.|..|.|..:|...|.|....|:    ...::.::|   ...|:.||...|.:.:|
 Worm   175 QSIMM-MYIALDRYASLYVGYWPFAENRKRLAYFLIAPLVFAFIL---MSSGIHYLILPFESFIY 235

  Fly   179 -RVVFVNVANCVYVVLLS---HIKYGVSNHDP 206
             |:..:.:.:.:..:|||   .||....|:||
 Worm   236 ARLALLLLPSAISFLLLSVCLVIKKERLNYDP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32263NP_728903.1 Mpv17_PMP22 135..198 CDD:282035 14/70 (20%)
ZK470.14NP_001257006.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.