DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG34437

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:235 Identity:51/235 - (21%)
Similarity:98/235 - (41%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 PWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCI-NPMLTLVRLGAHDLSQPAESGAMDLR 403
            ||:|.:....:|        |.|:||:.:||||:|.|: :...:.|.||..|......:..:...
  Fly    41 PWMAFIASPTKN--------CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHS 97

  Fly   404 IRRTVVHEHFDLNSISNDIALIELNVVGALPGNISPICLPEAAKFMQQDFVGMNPFVAG-WGAVK 467
            ::....|:.::..:..:||||:.|:.......:|.|||:      ...:...:|...:. |    
  Fly    98 VQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI------WLGEITNLNHLESNRW---- 152

  Fly   468 HQGVTSQVL--RDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQL 530
              |::.:::  |...|.|:....|..|:.     :......:|||..:.:.|.......:.....
  Fly   153 --GLSEKMIFQRINTVKILKIKKCRDSFG-----ITLKKSQICAGFQNGNICTETGSSLVKQIHY 210

  Fly   531 EGNVYRFYLLGLVSFGY--ECARPNFPGVYTRVASYVPWI 568
            .|.::. .|:|:.|:|.  .|       :|.::|.|:.||
  Fly   211 SGKLWN-TLIGIQSYGVSERC-------IYNKIAHYIDWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 49/233 (21%)
Tryp_SPc 328..571 CDD:238113 51/235 (22%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 49/233 (21%)
Tryp_SPc 39..242 CDD:304450 49/233 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.