DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and PRSS8

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:271 Identity:94/271 - (34%)
Similarity:138/271 - (50%) Gaps:34/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 ATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCI--- 377
            |.||:  |...|:.||..|..|.:||..::.|...:       :|||||:..::|:::|||.   
Human    35 APCGV--APQARITGGSSAVAGQWPWQVSITYEGVH-------VCGGSLVSEQWVLSAAHCFPSE 90

  Fly   378 -NPMLTLVRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGALPGNISPIC 441
             :.....|:||||.|...:|...:. .::..:.|..:.......||||::|:........|.|||
Human    91 HHKEAYEVKLGAHQLDSYSEDAKVS-TLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPIC 154

  Fly   442 LPEA-AKFMQQDFVGMNPFVAGWGAVKHQG--VTSQVLRDAQVPIVSRHSCEQSYKSIFQ----- 498
            ||.| |.|..    |::..|.|||.|....  :|.:.|:..:||::||.:|...|....:     
Human   155 LPAANASFPN----GLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPH 215

  Fly   499 FVQFSDKVLCAG--SSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRV 561
            |||  :.::|||  ....|||||||||||..| :||   .:||.|:||:|..|...|.|||||..
Human   216 FVQ--EDMVCAGYVEGGKDACQGDSGGPLSCP-VEG---LWYLTGIVSWGDACGARNRPGVYTLA 274

  Fly   562 ASYVPWIKKHI 572
            :||..||:..:
Human   275 SSYASWIQSKV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 88/254 (35%)
Tryp_SPc 328..571 CDD:238113 89/256 (35%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 88/254 (35%)
Tryp_SPc 45..284 CDD:238113 89/256 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.