DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and cela1.3

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_021324991.1 Gene:cela1.3 / 445032 ZFINID:ZDB-GENE-040801-12 Length:283 Species:Danio rerio


Alignment Length:265 Identity:83/265 - (31%)
Similarity:138/265 - (52%) Gaps:29/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 PRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHC 376
            ||......|.|    |||||..|:..::||..:|.|.   :.::....||||||...:|:|:|||
Zfish    33 PRYLEDIDIEG----RVVGGEVAKPNSWPWQISLQYL---SGSSYYHTCGGSLIRPGWVMTAAHC 90

  Fly   377 I-NPMLTLVRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISN--DIALIELNVVGALPGNIS 438
            : :|....|.||.||:.. .|.....:.:.|..:|.:::.||:|:  ||||:||:...:|...:.
Zfish    91 VDSPRTWRVVLGDHDIYN-HEGREQYISVSRAHIHPNWNSNSLSSGYDIALLELSSDASLNSYVQ 154

  Fly   439 PICLPEAAKFMQQDFVGMNP-FVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQS--YKSIFQFV 500
            ...||.:.:.:..:    || :::|||..:..|..|..|:.|.:|:|...:|.:|  :.|..:  
Zfish   155 LAALPPSGQVLPNN----NPCYISGWGRTQTGGSLSAELKQAYLPVVDHDTCSRSDWWGSTVK-- 213

  Fly   501 QFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSF--GYECARPNFPGVYTRVAS 563
               :.::|.|..::..|.|||||||.. |:.|   ::.:.|:.||  ...|.....|.|::||::
Zfish   214 ---NTMICGGDGTLAGCHGDSGGPLNC-QVSG---QYVVHGVTSFVSSAGCNTNKRPTVFSRVSA 271

  Fly   564 YVPWI 568
            |:.||
Zfish   272 YISWI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 77/248 (31%)
Tryp_SPc 328..571 CDD:238113 78/249 (31%)
cela1.3XP_021324991.1 Tryp_SPc 45..279 CDD:238113 78/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.