DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG11313

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:412 Identity:120/412 - (29%)
Similarity:169/412 - (41%) Gaps:98/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 SCQDARSRPGSCLPLTSCPQLMQEYQGQANEFHT---FLGQSICGFDGSTFM--VCCATDRSGNA 252
            ||::...|.|.|:.:..|..| .....::|...:   |:.:|.|.....:.:  |||..|...| 
  Fly    23 SCRNPNQRTGYCVNIPLCVPL-NSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTDYN- 85

  Fly   253 RSRKDVFVTTAAPFGFFHFSPLSGGSTATPMVFQPTPPLSQVVSPSFYPPPPPPPPNNAPRESAT 317
                    ||.|                        .|..:|:..:..|            :.:.
  Fly    86 --------TTRA------------------------RPNDEVIHSTLLP------------DRSI 106

  Fly   318 CGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCIN---- 378
            || .....|::..|.|.....:.|:..|.| ..::...|:..|.||||::|||:|:|||::    
  Fly   107 CG-GDIAYNQITKGNETVLTEFAWMVLLEY-RPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATR 169

  Fly   379 ------PMLTLVRLGAHD------------LSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALI 425
                  .....||||.|:            |.:|.:....::||     ||.|......||||||
  Fly   170 ARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRI-----HESFGTRLFWNDIALI 229

  Fly   426 ELNVVGALPGNISPICLPEAAKFMQQDFVGMNPF-VAGWGAVKHQGVTSQ---VLRDAQVPIVSR 486
            .|....|...:|.|:|||.....  |::.....| |||||    :.:||:   |....:|..|..
  Fly   230 RLAREVAYSPSIRPVCLPSTVGL--QNWQSGQAFTVAGWG----RTLTSESSPVKMKLRVTYVEP 288

  Fly   487 HSCEQSYKSIFQFVQFSDKVLCA-GSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECA 550
            ..|.:.|.||   |...|..||| |.|..|:|.||||||||... ||   .:.|.|:||||..|.
  Fly   289 GLCRRKYASI---VVLGDSHLCAEGRSRGDSCDGDSGGPLMAFH-EG---VWVLGGIVSFGLNCG 346

  Fly   551 RPNFPGVYTRVASYVPWIKKHI 572
            ...:|.|||.|.||..||.::|
  Fly   347 SRFWPAVYTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855 11/54 (20%)
Tryp_SPc 327..568 CDD:214473 92/267 (34%)
Tryp_SPc 328..571 CDD:238113 94/269 (35%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/54 (20%)
Tryp_SPc 116..367 CDD:238113 94/269 (35%)
Tryp_SPc 116..364 CDD:214473 92/266 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.