DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG11836

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:259 Identity:94/259 - (36%)
Similarity:141/259 - (54%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 CGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCINPM-L 381
            ||.|. ...|:|||.......|||:|.:.|..       ||.|||||:...||:::|||:..: .
  Fly    88 CGFSN-EEIRIVGGKPTGVNQYPWMARIVYDG-------KFHCGGSLLTKDYVLSAAHCVKKLRK 144

  Fly   382 TLVRL--GAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGALPGNISPICLPE 444
            :.:|:  |.||....:||.|:...:...:.|:.||.::.:|||||:.|....:....|.|||||.
  Fly   145 SKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPR 209

  Fly   445 AAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSC-EQSYKSIFQFVQFSDKVLC 508
                ...|..|....|.|||.....|....::...:|||:|...| .|.|||    .:.:..:||
  Fly   210 ----YNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKS----TRITSSMLC 266

  Fly   509 AGSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRVASYVPWIKKHI 572
            ||..|:|:|||||||||::    .|..:::::|:||:|..|.|..:||||:||:.::||||.::
  Fly   267 AGRPSMDSCQGDSGGPLLL----SNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 88/244 (36%)
Tryp_SPc 328..571 CDD:238113 90/246 (37%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 90/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.