DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG9616

DIOPT Version :10

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster


Alignment Length:151 Identity:32/151 - (21%)
Similarity:51/151 - (33%) Gaps:53/151 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 ALKFLCGGSLI-----------HSRY------------------VITSAHCINPMLTLVRLGAHD 390
            ||..||.|..:           |.||                  .|.|...:|.:.|....|..|
  Fly     7 ALLVLCAGPTLGLLVPQHYCDEHFRYAMKDKQQTYIGIFSAPDEAINSNTVLNWLATFEMQGKRD 71

  Fly   391 L------SQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIE-LNVVGALPGNISPICLPEAAKF 448
            |      :.|.::.|. :.|.|.:..|.|           :| ||:..||| .::.:.|.:....
  Fly    72 LFVGSMNTYPNKNEAA-INIVRGMPAEVF-----------VEFLNITNALP-KLTSLYLNDQLLC 123

  Fly   449 MQQDFVGMNPFVAGWGAVKHQ 469
            ..:::    ||......::||
  Fly   124 SNEEY----PFPKTRITLRHQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:463440
Tryp_SPc 328..571 CDD:238113 32/151 (21%)
CG9616NP_650347.2 GD_N 24..133 CDD:464985 25/125 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.