DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG10041

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:293 Identity:79/293 - (26%)
Similarity:129/293 - (44%) Gaps:76/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 PPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVI 371
            |.|:.|..:.|...:...|.|         ..||:|.::|   ||.:...|.||.|.::.:.:|:
  Fly    27 PQNSTPLLATTVSTTKVISFR---------PRYPYIVSIG---ENLKGYYKHLCVGVILSNEFVL 79

  Fly   372 TSAHCI--NPMLTL-VRLGAHDLSQPAES----------------GAMDLRIRRTVVHEHFDLNS 417
            ::||||  ||...| |..||..|:...::                |..|:.:.|  ::..|.|  
  Fly    80 SAAHCIQTNPTKQLYVAGGADSLNSRKQTRFFVVERRWHPQFRVLGGNDIAVLR--IYPKFPL-- 140

  Fly   418 ISNDIALIELNVVGALPGNISPICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVP 482
              :|:....:|..|      .|          |:| .|....:.|||.|   || .::.:..::|
  Fly   141 --DDVRFRSINFAG------KP----------QRD-SGTQASLVGWGRV---GV-GKIRKLQEMP 182

  Fly   483 IVSRHS--CEQSYKSIFQFVQFSDKVLCA----GSSSVDACQGDSGGPLMMPQLEGNVYRFYLLG 541
            .::..:  |:||::  |.|::..|  :||    |...  .|.||||.|||      ||.:..|.|
  Fly   183 FLTMENDECQQSHR--FVFLKPLD--ICAMHLKGPRG--PCDGDSGAPLM------NVAKEKLYG 235

  Fly   542 LVSFGYECARPNFPGVYTRVASYVPWIKKHIAS 574
            |:|:|.:...|..|..:||:.:|..||::.:.|
  Fly   236 LLSYGRKACTPLKPYAFTRINAYSSWIQESMDS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 71/265 (27%)
Tryp_SPc 328..571 CDD:238113 72/267 (27%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 72/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.