DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG16749

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:79/272 - (29%)
Similarity:128/272 - (47%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 TCGIS-GATS-NRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCINP 379
            |.||| ||.. .|||.|.::....||::.::      ..::....||||:|..::|:|:|||.:.
  Fly    17 TAGISHGAPQMGRVVNGTDSSVEKYPFVISM------RGSSGSHSCGGSIISKQFVMTAAHCTDG 75

  Fly   380 MLTLVRLGAHDLS------QPAESGAMDLRIRRTVVHEHFD-LNSISNDIALIELNVVGALPG-N 436
            .      .|.|||      :...:|...:|:::.:.||.:: .|:.:|||:|:.:.......| .
  Fly    76 R------KASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVT 134

  Fly   437 ISPICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQ 501
            ::|:.|||.|....|...|....:.|||.....|.....|::.::.:.|...|.:.:..      
  Fly   135 VAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGG------ 193

  Fly   502 FSDK--VLCAGSSSVD-----ACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYE-CARPNFPGVY 558
            .:|.  .:|.|   ||     .|.|||||||        :|....:|:||:..: |....:||||
  Fly   194 RTDPRYHICGG---VDEGGKGQCSGDSGGPL--------IYNGQQVGIVSWSIKPCTVAPYPGVY 247

  Fly   559 TRVASYVPWIKK 570
            .:|:.||.||||
  Fly   248 CKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 69/256 (27%)
Tryp_SPc 328..571 CDD:238113 72/259 (28%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 69/256 (27%)
Tryp_SPc 30..259 CDD:238113 70/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.