DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and prss29

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:271 Identity:100/271 - (36%)
Similarity:139/271 - (51%) Gaps:47/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCINPMLT---LVRL 386
            |.|:|||.::.:|.:||..:| .||..      |||||||:...:|:|:|||.:.|..   ...|
 Frog    23 SKRIVGGTDSEEGEWPWQISL-EFEGG------FLCGGSLLTDSWVLTAAHCFDSMNVSKYTAYL 80

  Fly   387 GAHDLSQPAESGAMDLRIRRTV----VHEHFDLNSISNDIALIELNVVGALPGNISPICLPEAAK 447
            |.:.||.      :|..:.|.|    ||..:.....|.|||||||........:|.|:|||    
 Frog    81 GVYQLSD------LDNAVLRGVKNITVHPDYMYEGSSGDIALIELEEPIVFTPSIQPVCLP---- 135

  Fly   448 FMQQDF---VGMNPFVAGWGAVKHQGVTS--QVLRDAQVPIVSRHSCEQSYKSIFQF------VQ 501
              .||.   :|...:|.|||.:|......  |.|:.|:|.:::|.|||..|:|...:      :|
 Frog   136 --SQDVPLPMGTMCWVTGWGNIKENTPLEDPQTLQKAEVGLINRTSCEAMYQSSLGYRPSIHLIQ 198

  Fly   502 FSDKVLCAG--SSSVDACQGDSGGPLMMPQLEGNVYRFYL-LGLVSFGYECARPNFPGVYTRVAS 563
              |.::|||  ...:|||||||||||:.     |....:| .|:||:|..||.||.|||||.|..
 Frog   199 --DDMICAGYKQGKIDACQGDSGGPLVC-----NTSNTWLQFGIVSWGLGCAEPNQPGVYTNVQY 256

  Fly   564 YVPWIKKHIAS 574
            |:.||::.:.|
 Frog   257 YLTWIQELVPS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 96/261 (37%)
Tryp_SPc 328..571 CDD:238113 97/263 (37%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 97/262 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.