DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG6865

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:271 Identity:89/271 - (32%)
Similarity:142/271 - (52%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 RVVGGMEARKGAYPWIAAL----GYFEENNRNALKFLCGGSLIHSRYVITSAHCI-NPMLTLVR- 385
            ::|||.||.:...|::.:|    |:|           |||::|..|:::|:.||| |.:...:: 
  Fly    34 KIVGGSEAERNEMPYMVSLMRRGGHF-----------CGGTIISERWILTAGHCICNGLQQFMKP 87

  Fly   386 ------LGAHDLSQPAE---SGAMDLRI--RRTVVHEHFDLNSISNDIALIELNVVGALPGNISP 439
                  :|.|.:.:...   :|...||:  :..|.|..:|.|.:.:||||:||........:|.|
  Fly    88 AQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQP 152

  Fly   440 ICL--PEAAKFMQQDFVGMNPFVAGWGAVKHQGVT----SQVLRDAQVPIVSRHSCEQSYKSIFQ 498
            .|:  .|..:.::|::    ..|:|||.. |:...    |.|||.|.|.|.:..:||:||:|:.:
  Fly   153 SCVGSEEGHRSLEQEY----GTVSGWGWT-HENQAENDRSDVLRKATVKIWNNEACERSYRSLGK 212

  Fly   499 FVQFSDKVLCAG--SSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRV 561
            .....:..||||  :..:|:|..|||||||..:       .:|:|:||.|..||||..||:||||
  Fly   213 SNTIGETQLCAGYENGQIDSCWADSGGPLMSKE-------HHLVGVVSTGIGCARPGLPGIYTRV 270

  Fly   562 ASYVPWIKKHI 572
            :.||.|::|.|
  Fly   271 SKYVSWMQKVI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 86/265 (32%)
Tryp_SPc 328..571 CDD:238113 87/267 (33%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 86/264 (33%)
Tryp_SPc 35..280 CDD:238113 87/267 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.